Anti GPR50 pAb (ATL-HPA054678)

Atlas Antibodies

SKU: ATL-HPA054678-25

• 
• 

Protein Description: G protein-coupled receptor 50
Gene Name: GPR50
Alternative Gene Name: H9, Mel1c
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031714: 34%, ENSRNOG00000011335: 37%
Entrez Gene ID: 9248
Uniprot ID: Q13585
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PTKPAASQLESDTIADLPDPTVVTTSTNDYHDVVVIDVEDDPDEMAV
• Gene Sequence: PTKPAASQLESDTIADLPDPTVVTTSTNDYHDVVVIDVEDDPDEMAV
• Gene ID - Mouse: ENSMUSG00000031714
• Gene ID - Rat: ENSRNOG00000011335
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.