Protein Description: G protein-coupled receptor 37 (endothelin receptor type B-like)
Gene Name: GPR37
Alternative Gene Name: EDNRBL, hET(B)R-LP, PAELR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039904: 63%, ENSRNOG00000002524: 66%
Entrez Gene ID: 2861
Uniprot ID: O15354
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GPR37
Alternative Gene Name: EDNRBL, hET(B)R-LP, PAELR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039904: 63%, ENSRNOG00000002524: 66%
Entrez Gene ID: 2861
Uniprot ID: O15354
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | RAGKLQGSHHKPLSKTANGLAGHEGWTIALPGRALAQNGSLGEGIHEPGGPRRGNSTNRRVRLKNPFYPLTQESYG |
Documents & Links for Anti GPR37 pAb (ATL-HPA068009) | |
Datasheet | Anti GPR37 pAb (ATL-HPA068009) Datasheet (External Link) |
Vendor Page | Anti GPR37 pAb (ATL-HPA068009) at Atlas |
Documents & Links for Anti GPR37 pAb (ATL-HPA068009) | |
Datasheet | Anti GPR37 pAb (ATL-HPA068009) Datasheet (External Link) |
Vendor Page | Anti GPR37 pAb (ATL-HPA068009) |