Anti GPR37 pAb (ATL-HPA068009)

Atlas Antibodies

SKU: ATL-HPA068009-25

• 

Protein Description: G protein-coupled receptor 37 (endothelin receptor type B-like)
Gene Name: GPR37
Alternative Gene Name: EDNRBL, hET(B)R-LP, PAELR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039904: 63%, ENSRNOG00000002524: 66%
Entrez Gene ID: 2861
Uniprot ID: O15354
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RAGKLQGSHHKPLSKTANGLAGHEGWTIALPGRALAQNGSLGEGIHEPGGPRRGNSTNRRVRLKNPFYPLTQESYG
• Gene Sequence: RAGKLQGSHHKPLSKTANGLAGHEGWTIALPGRALAQNGSLGEGIHEPGGPRRGNSTNRRVRLKNPFYPLTQESYG
• Gene ID - Mouse: ENSMUSG00000039904
• Gene ID - Rat: ENSRNOG00000002524
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.