Anti GPR180 pAb (ATL-HPA047250)

Atlas Antibodies

SKU:
ATL-HPA047250-25
  • Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: G protein-coupled receptor 180
Gene Name: GPR180
Alternative Gene Name: ITR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022131: 76%, ENSRNOG00000009766: 81%
Entrez Gene ID: 160897
Uniprot ID: Q86V85
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLSKAQLTMTMNQTEHNLTVSQIPSPQTWHVFYADKYTCQDDKENSQVEDIPFEMVLLNPDAEGNPFDHFSAGES
Gene Sequence KLSKAQLTMTMNQTEHNLTVSQIPSPQTWHVFYADKYTCQDDKENSQVEDIPFEMVLLNPDAEGNPFDHFSAGES
Gene ID - Mouse ENSMUSG00000022131
Gene ID - Rat ENSRNOG00000009766
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GPR180 pAb (ATL-HPA047250)
Datasheet Anti GPR180 pAb (ATL-HPA047250) Datasheet (External Link)
Vendor Page Anti GPR180 pAb (ATL-HPA047250) at Atlas Antibodies

Documents & Links for Anti GPR180 pAb (ATL-HPA047250)
Datasheet Anti GPR180 pAb (ATL-HPA047250) Datasheet (External Link)
Vendor Page Anti GPR180 pAb (ATL-HPA047250)