Anti GPR135 pAb (ATL-HPA045337)

Atlas Antibodies

SKU:
ATL-HPA045337-25
  • Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: G protein-coupled receptor 135
Gene Name: GPR135
Alternative Gene Name: HUMNPIIY20, PAFR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043398: 79%, ENSRNOG00000004499: 79%
Entrez Gene ID: 64582
Uniprot ID: Q8IZ08
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PNISMLLGRNREEGYRTRNVDAFLPSQGPGLQARSRSRLRNRYANRLGACNRMSSSNPASGVAGDVAMWARKNPVVLFCREGPPEPVTAVTKQP
Gene Sequence PNISMLLGRNREEGYRTRNVDAFLPSQGPGLQARSRSRLRNRYANRLGACNRMSSSNPASGVAGDVAMWARKNPVVLFCREGPPEPVTAVTKQP
Gene ID - Mouse ENSMUSG00000043398
Gene ID - Rat ENSRNOG00000004499
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GPR135 pAb (ATL-HPA045337)
Datasheet Anti GPR135 pAb (ATL-HPA045337) Datasheet (External Link)
Vendor Page Anti GPR135 pAb (ATL-HPA045337) at Atlas Antibodies

Documents & Links for Anti GPR135 pAb (ATL-HPA045337)
Datasheet Anti GPR135 pAb (ATL-HPA045337) Datasheet (External Link)
Vendor Page Anti GPR135 pAb (ATL-HPA045337)