Protein Description: G protein-coupled receptor 108
Gene Name: GPR108
Alternative Gene Name: LUSTR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005823: 96%, ENSRNOG00000046128: 94%
Entrez Gene ID: 56927
Uniprot ID: Q9NPR9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GPR108
Alternative Gene Name: LUSTR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005823: 96%, ENSRNOG00000046128: 94%
Entrez Gene ID: 56927
Uniprot ID: Q9NPR9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | QPTGNNPYLQLPQEDEEDVQMEQVMTDSGFREGLSKVNKTASGRELL |
Documents & Links for Anti GPR108 pAb (ATL-HPA063863) | |
Datasheet | Anti GPR108 pAb (ATL-HPA063863) Datasheet (External Link) |
Vendor Page | Anti GPR108 pAb (ATL-HPA063863) at Atlas |
Documents & Links for Anti GPR108 pAb (ATL-HPA063863) | |
Datasheet | Anti GPR108 pAb (ATL-HPA063863) Datasheet (External Link) |
Vendor Page | Anti GPR108 pAb (ATL-HPA063863) |