Anti GPN3 pAb (ATL-HPA047793)

Atlas Antibodies

SKU:
ATL-HPA047793-25
  • Immunohistochemical staining of human small intestine shows strong cytoplasmic and membranous positivity in glandular cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: GPN-loop GTPase 3
Gene Name: GPN3
Alternative Gene Name: ATPBD1C, MGC14560
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029464: 96%, ENSRNOG00000001278: 97%
Entrez Gene ID: 51184
Uniprot ID: Q9UHW5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGKSTYCATMVQHCEALNRSVQVVNLDPAAEHFNYSVMADIRELIEVDDVMEDDSLRFGPNGGLVFCMEYFANNFDWLE
Gene Sequence SGKSTYCATMVQHCEALNRSVQVVNLDPAAEHFNYSVMADIRELIEVDDVMEDDSLRFGPNGGLVFCMEYFANNFDWLE
Gene ID - Mouse ENSMUSG00000029464
Gene ID - Rat ENSRNOG00000001278
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GPN3 pAb (ATL-HPA047793)
Datasheet Anti GPN3 pAb (ATL-HPA047793) Datasheet (External Link)
Vendor Page Anti GPN3 pAb (ATL-HPA047793) at Atlas Antibodies

Documents & Links for Anti GPN3 pAb (ATL-HPA047793)
Datasheet Anti GPN3 pAb (ATL-HPA047793) Datasheet (External Link)
Vendor Page Anti GPN3 pAb (ATL-HPA047793)