Anti GPATCH4 pAb (ATL-HPA054319)

Atlas Antibodies

SKU: ATL-HPA054319-25

• 
• 

Protein Description: G patch domain containing 4
Gene Name: GPATCH4
Alternative Gene Name: DKFZP434F1735, FLJ20249, GPATC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028069: 85%, ENSRNOG00000018969: 89%
Entrez Gene ID: 54865
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RGMKFAEEQLLKHGWTQGKGLGRKENGITQALRVTLKQDTHGVGHDPAKEFTNHWWNELFNKTAANLVVETGQDGVQIRSLSKETTRY
• Gene Sequence: RGMKFAEEQLLKHGWTQGKGLGRKENGITQALRVTLKQDTHGVGHDPAKEFTNHWWNELFNKTAANLVVETGQDGVQIRSLSKETTRY
• Gene ID - Mouse: ENSMUSG00000028069
• Gene ID - Rat: ENSRNOG00000018969
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.