Protein Description: glycoprotein IX (platelet)
Gene Name: GP9
Alternative Gene Name: CD42a, GPIX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030054: 82%, ENSRNOG00000010015: 76%
Entrez Gene ID: 2815
Uniprot ID: P14770
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GP9
Alternative Gene Name: CD42a, GPIX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030054: 82%, ENSRNOG00000010015: 76%
Entrez Gene ID: 2815
Uniprot ID: P14770
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | HGLTALPALPARTRHLLLANNSLQSVPPGAFDHLPQLQTLDVTQNPWHCDC |
| Documents & Links for Anti GP9 pAb (ATL-HPA063182) | |
| Datasheet | Anti GP9 pAb (ATL-HPA063182) Datasheet (External Link) |
| Vendor Page | Anti GP9 pAb (ATL-HPA063182) at Atlas |
| Documents & Links for Anti GP9 pAb (ATL-HPA063182) | |
| Datasheet | Anti GP9 pAb (ATL-HPA063182) Datasheet (External Link) |
| Vendor Page | Anti GP9 pAb (ATL-HPA063182) |