Protein Description: glycoprotein VI (platelet)
Gene Name: GP6
Alternative Gene Name: GPVI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078810: 78%, ENSRNOG00000047204: 65%
Entrez Gene ID: 51206
Uniprot ID: Q9HCN6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GP6
Alternative Gene Name: GPVI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078810: 78%, ENSRNOG00000047204: 65%
Entrez Gene ID: 51206
Uniprot ID: Q9HCN6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | VTLRCQGPPGVDLYRLEKLSSSRYQDQAVLFIPAMKRSLAGRYRCSYQNGSLWSLPSDQL |
Documents & Links for Anti GP6 pAb (ATL-HPA066482) | |
Datasheet | Anti GP6 pAb (ATL-HPA066482) Datasheet (External Link) |
Vendor Page | Anti GP6 pAb (ATL-HPA066482) at Atlas |
Documents & Links for Anti GP6 pAb (ATL-HPA066482) | |
Datasheet | Anti GP6 pAb (ATL-HPA066482) Datasheet (External Link) |
Vendor Page | Anti GP6 pAb (ATL-HPA066482) |