Protein Description: glycoprotein V platelet
Gene Name: GP5
Alternative Gene Name: CD42d
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047953: 77%, ENSRNOG00000061705: 78%
Entrez Gene ID: 2814
Uniprot ID: P40197
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GP5
Alternative Gene Name: CD42d
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047953: 77%, ENSRNOG00000061705: 78%
Entrez Gene ID: 2814
Uniprot ID: P40197
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | GNNLTHLPKGLLGAQAKLERLLLHSNRLVSLDSGLLNSLGALTELQFHRNHIRSIAPGAFDRLP |
Documents & Links for Anti GP5 pAb (ATL-HPA072646) | |
Datasheet | Anti GP5 pAb (ATL-HPA072646) Datasheet (External Link) |
Vendor Page | Anti GP5 pAb (ATL-HPA072646) at Atlas |
Documents & Links for Anti GP5 pAb (ATL-HPA072646) | |
Datasheet | Anti GP5 pAb (ATL-HPA072646) Datasheet (External Link) |
Vendor Page | Anti GP5 pAb (ATL-HPA072646) |