Anti GOSR2 pAb (ATL-HPA048956)
Atlas Antibodies
- SKU:
- ATL-HPA048956-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: GOSR2
Alternative Gene Name: Bos1, GS27
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020946: 85%, ENSRNOG00000003506: 91%
Entrez Gene ID: 9570
Uniprot ID: O14653
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQG |
Gene Sequence | PLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQG |
Gene ID - Mouse | ENSMUSG00000020946 |
Gene ID - Rat | ENSRNOG00000003506 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GOSR2 pAb (ATL-HPA048956) | |
Datasheet | Anti GOSR2 pAb (ATL-HPA048956) Datasheet (External Link) |
Vendor Page | Anti GOSR2 pAb (ATL-HPA048956) at Atlas Antibodies |
Documents & Links for Anti GOSR2 pAb (ATL-HPA048956) | |
Datasheet | Anti GOSR2 pAb (ATL-HPA048956) Datasheet (External Link) |
Vendor Page | Anti GOSR2 pAb (ATL-HPA048956) |