Anti GORASP1 pAb (ATL-HPA056283 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA056283-25

• 
• 
• 

Protein Description: golgi reassembly stacking protein 1, 65kDa
Gene Name: GORASP1
Alternative Gene Name: FLJ23443, GOLPH5, GRASP65, P65
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032513: 75%, ENSRNOG00000018047: 71%
Entrez Gene ID: 64689
Uniprot ID: Q9BQQ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GGEATWSGSEFEVSFLDSPGAQAQADHLPQLTLPDSLTSAASPEDGLSAELLEAQAEEEPASTEGLDTGTEAEGLDSQAQISTTE
• Gene Sequence: GGEATWSGSEFEVSFLDSPGAQAQADHLPQLTLPDSLTSAASPEDGLSAELLEAQAEEEPASTEGLDTGTEAEGLDSQAQISTTE
• Gene ID - Mouse: ENSMUSG00000032513
• Gene ID - Rat: ENSRNOG00000018047
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.