Anti GOLGA6A pAb (ATL-HPA044978)

Atlas Antibodies

SKU: ATL-HPA044978-25

• 

Protein Description: golgin A6 family, member A
Gene Name: GOLGA6A
Alternative Gene Name: GLP, GOLGA6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020827: 35%, ENSRNOG00000056462: 35%
Entrez Gene ID: 342096
Uniprot ID: Q9NYA3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GVTDGMRESFTVYESQGAVPNTRHQEMEDVIRLA
• Gene Sequence: GVTDGMRESFTVYESQGAVPNTRHQEMEDVIRLA
• Gene ID - Mouse: ENSMUSG00000020827
• Gene ID - Rat: ENSRNOG00000056462
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.