Anti GNS pAb (ATL-HPA048508 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA048508-25
  • Immunohistochemistry analysis in human kidney and skin tissues using HPA048508 antibody. Corresponding GNS RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: glucosamine (N-acetyl)-6-sulfatase
Gene Name: GNS
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034707: 94%, ENSRNOG00000047350: 92%
Entrez Gene ID: 2799
Uniprot ID: P15586
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NYTLSINGKARKHGENYSVDYLTDVLANVSLDFLDYKSNFEPFFMMIATPAPHSPWTAAPQYQKAFQNVFAPRNKNFNIHGTNKHWLIRQAKTPMTNSSIQFLDNAFRKRWQTL
Gene Sequence NYTLSINGKARKHGENYSVDYLTDVLANVSLDFLDYKSNFEPFFMMIATPAPHSPWTAAPQYQKAFQNVFAPRNKNFNIHGTNKHWLIRQAKTPMTNSSIQFLDNAFRKRWQTL
Gene ID - Mouse ENSMUSG00000034707
Gene ID - Rat ENSRNOG00000047350
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GNS pAb (ATL-HPA048508 w/enhanced validation)
Datasheet Anti GNS pAb (ATL-HPA048508 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GNS pAb (ATL-HPA048508 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GNS pAb (ATL-HPA048508 w/enhanced validation)
Datasheet Anti GNS pAb (ATL-HPA048508 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GNS pAb (ATL-HPA048508 w/enhanced validation)