Anti GNPDA1 pAb (ATL-HPA046891)

Atlas Antibodies

SKU: ATL-HPA046891-25

• 

Protein Description: glucosamine-6-phosphate deaminase 1
Gene Name: GNPDA1
Alternative Gene Name: GNPDA, GNPI, GPI, HLN, KIAA0060
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029209: 99%, ENSRNOG00000002177: 100%
Entrez Gene ID: 10007
Uniprot ID: P46926
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSKVPTMALTVGVGTVMDAREVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQHPRTIFVCDEDAT
• Gene Sequence: LSKVPTMALTVGVGTVMDAREVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQHPRTIFVCDEDAT
• Gene ID - Mouse: ENSMUSG00000029209
• Gene ID - Rat: ENSRNOG00000002177
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.