Anti GNL2 pAb (ATL-HPA060026)

Atlas Antibodies

SKU: ATL-HPA060026-25

• 
• 

Protein Description: guanine nucleotide binding protein-like 2 (nucleolar)
Gene Name: GNL2
Alternative Gene Name: HUMAUANTIG, Ngp-1, Nog2, Nug2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028869: 99%, ENSRNOG00000009430: 99%
Entrez Gene ID: 29889
Uniprot ID: Q13823
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NAEMSTESYDQGKDRDLVTEDTGVRNEAQEEIYKKGQSKRIWGELYKVIDSSDVVVQVLDARDPMGTRSPH
• Gene Sequence: NAEMSTESYDQGKDRDLVTEDTGVRNEAQEEIYKKGQSKRIWGELYKVIDSSDVVVQVLDARDPMGTRSPH
• Gene ID - Mouse: ENSMUSG00000028869
• Gene ID - Rat: ENSRNOG00000009430
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.