Anti GNL1 pAb (ATL-HPA050455 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA050455-25

• 
• 

Protein Description: guanine nucleotide binding protein-like 1
Gene Name: GNL1
Alternative Gene Name: HSR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024429: 89%, ENSRNOG00000000798: 93%
Entrez Gene ID: 2794
Uniprot ID: P36915
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VAWKHYFHQHYPQLHVVLFTSFPRDPRTPQDPSSVLKKSRRRGRGWTRALGPEQLLRACEAITVGKVDLSSWREKIARDVAGATWGNGSGE
• Gene Sequence: VAWKHYFHQHYPQLHVVLFTSFPRDPRTPQDPSSVLKKSRRRGRGWTRALGPEQLLRACEAITVGKVDLSSWREKIARDVAGATWGNGSGE
• Gene ID - Mouse: ENSMUSG00000024429
• Gene ID - Rat: ENSRNOG00000000798
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.