Anti GNG13 pAb (ATL-HPA046272)

Atlas Antibodies

SKU: ATL-HPA046272-25

• 

Protein Description: guanine nucleotide binding protein (G protein), gamma 13
Gene Name: GNG13
Alternative Gene Name: G(gamma)13, h2-35
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025739: 96%, ENSRNOG00000039350: 96%
Entrez Gene ID: 51764
Uniprot ID: Q9P2W3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVEKGKCTIL
• Gene Sequence: MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVEKGKCTIL
• Gene ID - Mouse: ENSMUSG00000025739
• Gene ID - Rat: ENSRNOG00000039350
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GNG13 pAb (ATL-HPA046272) – 1 Found

AlMatrouk, Abdullah; Lemons, Kayla; Ogura, Tatsuya; Luo, Wangmei; Wilson, Chantel; Lin, Weihong. Chemical Exposure-Induced Changes in the Expression of Neurotrophins and Their Receptors in the Main Olfactory System of Mice Lacking TRPM5-Expressing Microvillous Cells. International Journal Of Molecular Sciences. 2018;19(10)