Anti GLUD1 pAb (ATL-HPA061369)

Atlas Antibodies

SKU:
ATL-HPA061369-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: glutamate dehydrogenase 1
Gene Name: GLUD1
Alternative Gene Name: GDH, GLUD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021794: 100%, ENSRNOG00000057367: 99%
Entrez Gene ID: 2746
Uniprot ID: P00367
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DMSTGEREMSWIADTYASTIGHYDINAHACVTGKPISQGGIHGRISATGRGVFHGIENFINEASYMSILGMTPGFGDK
Gene Sequence DMSTGEREMSWIADTYASTIGHYDINAHACVTGKPISQGGIHGRISATGRGVFHGIENFINEASYMSILGMTPGFGDK
Gene ID - Mouse ENSMUSG00000021794
Gene ID - Rat ENSRNOG00000057367
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GLUD1 pAb (ATL-HPA061369)
Datasheet Anti GLUD1 pAb (ATL-HPA061369) Datasheet (External Link)
Vendor Page Anti GLUD1 pAb (ATL-HPA061369) at Atlas Antibodies

Documents & Links for Anti GLUD1 pAb (ATL-HPA061369)
Datasheet Anti GLUD1 pAb (ATL-HPA061369) Datasheet (External Link)
Vendor Page Anti GLUD1 pAb (ATL-HPA061369)



Citations for Anti GLUD1 pAb (ATL-HPA061369) – 1 Found
Zhao, Xiao; Karpac, Jason. Glutamate metabolism directs energetic trade-offs to shape host-pathogen susceptibility in Drosophila. Cell Metabolism. 2021;33(12):2428-2444.e8.  PubMed