Anti GLRX pAb (ATL-HPA046431)

Atlas Antibodies

SKU:
ATL-HPA046431-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic and nuclear positivity in cells in tubules.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: glutaredoxin (thioltransferase)
Gene Name: GLRX
Alternative Gene Name: GRX, GRX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021591: 97%, ENSRNOG00000012183: 97%
Entrez Gene ID: 2745
Uniprot ID: P35754
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IQDYLQQLTGARTVPRVFIGKDCIGGCSDLVS
Gene Sequence IQDYLQQLTGARTVPRVFIGKDCIGGCSDLVS
Gene ID - Mouse ENSMUSG00000021591
Gene ID - Rat ENSRNOG00000012183
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GLRX pAb (ATL-HPA046431)
Datasheet Anti GLRX pAb (ATL-HPA046431) Datasheet (External Link)
Vendor Page Anti GLRX pAb (ATL-HPA046431) at Atlas Antibodies

Documents & Links for Anti GLRX pAb (ATL-HPA046431)
Datasheet Anti GLRX pAb (ATL-HPA046431) Datasheet (External Link)
Vendor Page Anti GLRX pAb (ATL-HPA046431)