Anti GLRB pAb (ATL-HPA052363)

Atlas Antibodies

SKU:
ATL-HPA052363-25
  • Immunohistochemical staining of human hippocampus shows positivity in glial cells and processes of the brain.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: glycine receptor, beta
Gene Name: GLRB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028020: 97%, ENSRNOG00000010199: 97%
Entrez Gene ID: 2743
Uniprot ID: P48167
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MLNNPKRVEAEKARIAKAEQADGKGGNVAKKNTVNGTGTPVHISTLQVGETRCKKVCTSKSDLRSNDFSIVGSLPRDFELSNYDCYGKPIEVNNGLGKSQAKNNKKPPPAKPVIPTAAK
Gene Sequence MLNNPKRVEAEKARIAKAEQADGKGGNVAKKNTVNGTGTPVHISTLQVGETRCKKVCTSKSDLRSNDFSIVGSLPRDFELSNYDCYGKPIEVNNGLGKSQAKNNKKPPPAKPVIPTAAK
Gene ID - Mouse ENSMUSG00000028020
Gene ID - Rat ENSRNOG00000010199
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GLRB pAb (ATL-HPA052363)
Datasheet Anti GLRB pAb (ATL-HPA052363) Datasheet (External Link)
Vendor Page Anti GLRB pAb (ATL-HPA052363) at Atlas Antibodies

Documents & Links for Anti GLRB pAb (ATL-HPA052363)
Datasheet Anti GLRB pAb (ATL-HPA052363) Datasheet (External Link)
Vendor Page Anti GLRB pAb (ATL-HPA052363)