Anti GLI1 pAb (ATL-HPA068903)

Atlas Antibodies

SKU:
ATL-HPA068903-25
  • Immunofluorescent staining of human cell line RH-30 shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: GLI family zinc finger 1
Gene Name: GLI1
Alternative Gene Name: GLI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025407: 67%, ENSRNOG00000025120: 65%
Entrez Gene ID: 2735
Uniprot ID: P08151
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PCLDFDSPTHSTGQLKAQLVCNYVQSQQELLWEGGGREDAPAQEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHKSGSYP
Gene Sequence PCLDFDSPTHSTGQLKAQLVCNYVQSQQELLWEGGGREDAPAQEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHKSGSYP
Gene ID - Mouse ENSMUSG00000025407
Gene ID - Rat ENSRNOG00000025120
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GLI1 pAb (ATL-HPA068903)
Datasheet Anti GLI1 pAb (ATL-HPA068903) Datasheet (External Link)
Vendor Page Anti GLI1 pAb (ATL-HPA068903) at Atlas Antibodies

Documents & Links for Anti GLI1 pAb (ATL-HPA068903)
Datasheet Anti GLI1 pAb (ATL-HPA068903) Datasheet (External Link)
Vendor Page Anti GLI1 pAb (ATL-HPA068903)