Anti GLI1 pAb (ATL-HPA065172)

Catalog No:
ATL-HPA065172-25
$360.00
Protein Description: GLI family zinc finger 1
Gene Name: GLI1
Alternative Gene Name: GLI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025407: 88%, ENSRNOG00000025120: 91%
Entrez Gene ID: 2735
Uniprot ID: P08151
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence PPENGASSLPGLMPAQHYLLRARYASARGGGTSPTAASSLDRIGGLPMPPWRSRAEYPGYNPNAGVTRRASDPAQAADRPAPARVQRFKS

Documents & Links for Anti GLI1 pAb (ATL-HPA065172)
Datasheet Anti GLI1 pAb (ATL-HPA065172) Datasheet (External Link)
Vendor Page Anti GLI1 pAb (ATL-HPA065172) at Atlas

Documents & Links for Anti GLI1 pAb (ATL-HPA065172)
Datasheet Anti GLI1 pAb (ATL-HPA065172) Datasheet (External Link)
Vendor Page Anti GLI1 pAb (ATL-HPA065172)

Citations for Anti GLI1 pAb (ATL-HPA065172) – 3 Found
Belgacemi, Randa; Luczka, Emilie; Ancel, Julien; Diabasana, Zania; Perotin, Jeanne-Marie; Germain, Adeline; Lalun, Nathalie; Birembaut, Philippe; Dubernard, Xavier; Mérol, Jean-Claude; Delepine, Gonzague; Polette, Myriam; Deslée, Gaëtan; Dormoy, Valérian. Airway epithelial cell differentiation relies on deficient Hedgehog signalling in COPD. Ebiomedicine. 2020;51( 31877414):102572.  PubMed
Ancel, Julien; Belgacemi, Randa; Perotin, Jeanne-Marie; Diabasana, Zania; Dury, Sandra; Dewolf, Maxime; Bonnomet, Arnaud; Lalun, Nathalie; Birembaut, Philippe; Polette, Myriam; Deslée, Gaëtan; Dormoy, Valérian. Sonic hedgehog signalling as a potential endobronchial biomarker in COPD. Respiratory Research. 2020;21(1):207.  PubMed
Jacquet, A; Dormoy, V; Lorenzato, M; Durlach, A. Preliminary results on a proposed histopathological assessment of predictive factors for basal cell carcinoma recurrence after primary free margin excision. Skin Health And Disease. 2022;2(2):e88.  PubMed