Anti GLDC pAb (ATL-HPA052887 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA052887-25
  • Immunohistochemistry analysis in human kidney and cervix, uterine tissues using HPA052887 antibody. Corresponding GLDC RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line Hep G2 shows localization to nucleus & mitochondria.
  • Western blot analysis in human cell lines Caco-2 and HeLa using Anti-GLDC antibody. Corresponding GLDC RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: glycine dehydrogenase (decarboxylating)
Gene Name: GLDC
Alternative Gene Name: GCSP, NKH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024827: 91%, ENSRNOG00000011599: 92%
Entrez Gene ID: 2731
Uniprot ID: P23378
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SCTMKLNSSSELAPITWKEFANIHPFVPLDQAQGYQQLFRELEKDLCELTGYDQVCFQPNSGAQGEYAGLATIRAYLNQKGEGHRTVCLIPKSAHGTNPASAHMAGMKIQPVEVDKYGNIDAVHLKAMVDKHKENL
Gene Sequence SCTMKLNSSSELAPITWKEFANIHPFVPLDQAQGYQQLFRELEKDLCELTGYDQVCFQPNSGAQGEYAGLATIRAYLNQKGEGHRTVCLIPKSAHGTNPASAHMAGMKIQPVEVDKYGNIDAVHLKAMVDKHKENL
Gene ID - Mouse ENSMUSG00000024827
Gene ID - Rat ENSRNOG00000011599
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GLDC pAb (ATL-HPA052887 w/enhanced validation)
Datasheet Anti GLDC pAb (ATL-HPA052887 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GLDC pAb (ATL-HPA052887 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GLDC pAb (ATL-HPA052887 w/enhanced validation)
Datasheet Anti GLDC pAb (ATL-HPA052887 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GLDC pAb (ATL-HPA052887 w/enhanced validation)