Anti GLB1L2 pAb (ATL-HPA054808)

Atlas Antibodies

SKU:
ATL-HPA054808-25
  • Immunohistochemical staining of human cerebellum shows moderate nuclear positivity in Purkinje cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: galactosidase, beta 1-like 2
Gene Name: GLB1L2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036395: 74%, ENSRNOG00000007561: 80%
Entrez Gene ID: 89944
Uniprot ID: Q8IW92
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RGRVNYGENIDDQRKGLIGNLYLNDSPLKNFRIYSLDMKKSFFQRFGLDKWSSL
Gene Sequence RGRVNYGENIDDQRKGLIGNLYLNDSPLKNFRIYSLDMKKSFFQRFGLDKWSSL
Gene ID - Mouse ENSMUSG00000036395
Gene ID - Rat ENSRNOG00000007561
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GLB1L2 pAb (ATL-HPA054808)
Datasheet Anti GLB1L2 pAb (ATL-HPA054808) Datasheet (External Link)
Vendor Page Anti GLB1L2 pAb (ATL-HPA054808) at Atlas Antibodies

Documents & Links for Anti GLB1L2 pAb (ATL-HPA054808)
Datasheet Anti GLB1L2 pAb (ATL-HPA054808) Datasheet (External Link)
Vendor Page Anti GLB1L2 pAb (ATL-HPA054808)