Anti GKN2 pAb (ATL-HPA057765 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA057765-25
  • Immunohistochemistry analysis in human stomach and pancreas tissues using Anti-GKN2 antibody. Corresponding GKN2 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added

Product Description

Protein Description: gastrokine 2
Gene Name: GKN2
Alternative Gene Name: blottin, BRICD1B, GDDR, PRO813, TFIZ1, VLTI465
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030049: 59%, ENSRNOG00000009256: 65%
Entrez Gene ID: 200504
Uniprot ID: Q86XP6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPLNNLQWYIYEKQALDNMFSSKYTWVKYNPLESLIKDVDWFLLGSPIEKLCKHIPLYKGEVVENT
Gene Sequence PPLNNLQWYIYEKQALDNMFSSKYTWVKYNPLESLIKDVDWFLLGSPIEKLCKHIPLYKGEVVENT
Gene ID - Mouse ENSMUSG00000030049
Gene ID - Rat ENSRNOG00000009256
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti GKN2 pAb (ATL-HPA057765 w/enhanced validation)
Datasheet Anti GKN2 pAb (ATL-HPA057765 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GKN2 pAb (ATL-HPA057765 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GKN2 pAb (ATL-HPA057765 w/enhanced validation)
Datasheet Anti GKN2 pAb (ATL-HPA057765 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GKN2 pAb (ATL-HPA057765 w/enhanced validation)