Anti GK pAb (ATL-HPA060687)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060687-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GK
Alternative Gene Name: GK1, GKD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025059: 96%, ENSRNOG00000034116: 96%
Entrez Gene ID: 2710
Uniprot ID: P32189
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IERLAKEVGTSYGCYFVPAFSGLYAPYWEPSARGILCGLTQFTNKCHIAFAALEAVCFQTREILEAMNRDCGIPL |
Gene Sequence | IERLAKEVGTSYGCYFVPAFSGLYAPYWEPSARGILCGLTQFTNKCHIAFAALEAVCFQTREILEAMNRDCGIPL |
Gene ID - Mouse | ENSMUSG00000025059 |
Gene ID - Rat | ENSRNOG00000034116 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GK pAb (ATL-HPA060687) | |
Datasheet | Anti GK pAb (ATL-HPA060687) Datasheet (External Link) |
Vendor Page | Anti GK pAb (ATL-HPA060687) at Atlas Antibodies |
Documents & Links for Anti GK pAb (ATL-HPA060687) | |
Datasheet | Anti GK pAb (ATL-HPA060687) Datasheet (External Link) |
Vendor Page | Anti GK pAb (ATL-HPA060687) |