Protein Description: gap junction protein, alpha 9, 59kDa
Gene Name: GJA9
Alternative Gene Name: CX58, CX59, GJA10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026153: 27%, ENSRNOG00000047447: 26%
Entrez Gene ID: 81025
Uniprot ID: P57773
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GJA9
Alternative Gene Name: CX58, CX59, GJA10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026153: 27%, ENSRNOG00000047447: 26%
Entrez Gene ID: 81025
Uniprot ID: P57773
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LNGNQLMEKRETEGKDSKRNYYSRGHRSIPGVAIDGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHENRGSPPKGN |
Documents & Links for Anti GJA9 pAb (ATL-HPA067850) | |
Datasheet | Anti GJA9 pAb (ATL-HPA067850) Datasheet (External Link) |
Vendor Page | Anti GJA9 pAb (ATL-HPA067850) at Atlas |
Documents & Links for Anti GJA9 pAb (ATL-HPA067850) | |
Datasheet | Anti GJA9 pAb (ATL-HPA067850) Datasheet (External Link) |
Vendor Page | Anti GJA9 pAb (ATL-HPA067850) |