Anti GJA9 pAb (ATL-HPA067850)

Atlas Antibodies

SKU:
ATL-HPA067850-25
  • Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: gap junction protein, alpha 9, 59kDa
Gene Name: GJA9
Alternative Gene Name: CX58, CX59, GJA10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026153: 27%, ENSRNOG00000047447: 26%
Entrez Gene ID: 81025
Uniprot ID: P57773
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LNGNQLMEKRETEGKDSKRNYYSRGHRSIPGVAIDGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHENRGSPPKGN
Gene Sequence LNGNQLMEKRETEGKDSKRNYYSRGHRSIPGVAIDGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHENRGSPPKGN
Gene ID - Mouse ENSMUSG00000026153
Gene ID - Rat ENSRNOG00000047447
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GJA9 pAb (ATL-HPA067850)
Datasheet Anti GJA9 pAb (ATL-HPA067850) Datasheet (External Link)
Vendor Page Anti GJA9 pAb (ATL-HPA067850) at Atlas Antibodies

Documents & Links for Anti GJA9 pAb (ATL-HPA067850)
Datasheet Anti GJA9 pAb (ATL-HPA067850) Datasheet (External Link)
Vendor Page Anti GJA9 pAb (ATL-HPA067850)