Protein Description: gap junction protein, alpha 9, 59kDa
Gene Name: GJA9
Alternative Gene Name: CX58, CX59, GJA10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026153: 27%, ENSRNOG00000047447: 26%
Entrez Gene ID: 81025
Uniprot ID: P57773
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GJA9
Alternative Gene Name: CX58, CX59, GJA10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026153: 27%, ENSRNOG00000047447: 26%
Entrez Gene ID: 81025
Uniprot ID: P57773
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LNGNQLMEKRETEGKDSKRNYYSRGHRSIPGVAIDGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHENRGSPPKGN |
| Documents & Links for Anti GJA9 pAb (ATL-HPA067850) | |
| Datasheet | Anti GJA9 pAb (ATL-HPA067850) Datasheet (External Link) |
| Vendor Page | Anti GJA9 pAb (ATL-HPA067850) at Atlas |
| Documents & Links for Anti GJA9 pAb (ATL-HPA067850) | |
| Datasheet | Anti GJA9 pAb (ATL-HPA067850) Datasheet (External Link) |
| Vendor Page | Anti GJA9 pAb (ATL-HPA067850) |