Anti GJA5 pAb (ATL-HPA071370 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA071370-25

• 

Protein Description: gap junction protein alpha 5
Gene Name: GJA5
Alternative Gene Name: CX40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057123: 63%, ENSRNOG00000017484: 62%
Entrez Gene ID: 2702
Uniprot ID: P36382
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KKIRQRFVKPRQHMAKCQLSGPSVGIVQSCTPPPDFNQCLENGPGGKFFNPFSNNMASQQNTDNLVTEQVRGQEQTPG
• Gene Sequence: KKIRQRFVKPRQHMAKCQLSGPSVGIVQSCTPPPDFNQCLENGPGGKFFNPFSNNMASQQNTDNLVTEQVRGQEQTPG
• Gene ID - Mouse: ENSMUSG00000057123
• Gene ID - Rat: ENSRNOG00000017484
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.