Protein Description: gap junction protein alpha 5
Gene Name: GJA5
Alternative Gene Name: CX40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057123: 63%, ENSRNOG00000017484: 62%
Entrez Gene ID: 2702
Uniprot ID: P36382
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GJA5
Alternative Gene Name: CX40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057123: 63%, ENSRNOG00000017484: 62%
Entrez Gene ID: 2702
Uniprot ID: P36382
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KKIRQRFVKPRQHMAKCQLSGPSVGIVQSCTPPPDFNQCLENGPGGKFFNPFSNNMASQQNTDNLVTEQVRGQEQTPG |
Documents & Links for Anti GJA5 pAb (ATL-HPA071370 w/enhanced validation) | |
Datasheet | Anti GJA5 pAb (ATL-HPA071370 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GJA5 pAb (ATL-HPA071370 w/enhanced validation) at Atlas |
Documents & Links for Anti GJA5 pAb (ATL-HPA071370 w/enhanced validation) | |
Datasheet | Anti GJA5 pAb (ATL-HPA071370 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GJA5 pAb (ATL-HPA071370 w/enhanced validation) |