Anti GINS3 pAb (ATL-HPA048209)

Atlas Antibodies

SKU: ATL-HPA048209-25

• 

Protein Description: GINS complex subunit 3 (Psf3 homolog)
Gene Name: GINS3
Alternative Gene Name: FLJ13912, PSF3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031669: 96%, ENSRNOG00000011863: 96%
Entrez Gene ID: 64785
Uniprot ID: Q9BRX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLL
• Gene Sequence: PLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLL
• Gene ID - Mouse: ENSMUSG00000031669
• Gene ID - Rat: ENSRNOG00000011863
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.