Anti GINS1 pAb (ATL-HPA051185)

Atlas Antibodies

SKU: ATL-HPA051185-25

• 
• 
• 

Protein Description: GINS complex subunit 1 (Psf1 homolog)
Gene Name: GINS1
Alternative Gene Name: KIAA0186, PSF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027454: 94%, ENSRNOG00000008091: 94%
Entrez Gene ID: 9837
Uniprot ID: Q14691
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRWKCEQLIRQGVLEH
• Gene Sequence: HMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRWKCEQLIRQGVLEH
• Gene ID - Mouse: ENSMUSG00000027454
• Gene ID - Rat: ENSRNOG00000008091
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.