Anti GIN1 pAb (ATL-HPA061362)
Atlas Antibodies
- SKU:
- ATL-HPA061362-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GIN1
Alternative Gene Name: FLJ20125, GIN-1, TGIN1, ZH2C2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026333: 91%, ENSRNOG00000011962: 89%
Entrez Gene ID: 54826
Uniprot ID: Q9NXP7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | WKDGRFQSEWVGPCVIDYITESGCAVLRDNTGVRLKRPIKMSHLKPYIRESSEQESLYLLQGSVVADHDYIGLPEIPIGA |
Gene Sequence | WKDGRFQSEWVGPCVIDYITESGCAVLRDNTGVRLKRPIKMSHLKPYIRESSEQESLYLLQGSVVADHDYIGLPEIPIGA |
Gene ID - Mouse | ENSMUSG00000026333 |
Gene ID - Rat | ENSRNOG00000011962 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GIN1 pAb (ATL-HPA061362) | |
Datasheet | Anti GIN1 pAb (ATL-HPA061362) Datasheet (External Link) |
Vendor Page | Anti GIN1 pAb (ATL-HPA061362) at Atlas Antibodies |
Documents & Links for Anti GIN1 pAb (ATL-HPA061362) | |
Datasheet | Anti GIN1 pAb (ATL-HPA061362) Datasheet (External Link) |
Vendor Page | Anti GIN1 pAb (ATL-HPA061362) |