Anti GIMAP6 pAb (ATL-HPA050740)

Atlas Antibodies

SKU:
ATL-HPA050740-25
  • Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: GTPase, IMAP family member 6
Gene Name: GIMAP6
Alternative Gene Name: FLJ22690, IAN6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047867: 38%, ENSRNOG00000008416: 38%
Entrez Gene ID: 474344
Uniprot ID: Q6P9H5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLEDYVRETNNQALAWLDVTLARRHCGFNNRAQGEEQEAQLRELMEKVEAIMWENEGDYYSNKAYQYTQQNFRLKELQERQVSQGQGSEDVPGEESWLEGLSQIQK
Gene Sequence SLEDYVRETNNQALAWLDVTLARRHCGFNNRAQGEEQEAQLRELMEKVEAIMWENEGDYYSNKAYQYTQQNFRLKELQERQVSQGQGSEDVPGEESWLEGLSQIQK
Gene ID - Mouse ENSMUSG00000047867
Gene ID - Rat ENSRNOG00000008416
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GIMAP6 pAb (ATL-HPA050740)
Datasheet Anti GIMAP6 pAb (ATL-HPA050740) Datasheet (External Link)
Vendor Page Anti GIMAP6 pAb (ATL-HPA050740) at Atlas Antibodies

Documents & Links for Anti GIMAP6 pAb (ATL-HPA050740)
Datasheet Anti GIMAP6 pAb (ATL-HPA050740) Datasheet (External Link)
Vendor Page Anti GIMAP6 pAb (ATL-HPA050740)