Anti GIMAP1 pAb (ATL-HPA053441)

Atlas Antibodies

SKU: ATL-HPA053441-25

• 
• 

Protein Description: GTPase, IMAP family member 1
Gene Name: GIMAP1
Alternative Gene Name: HIMAP1, IAN2, IMAP1, IMAP38
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090019: 63%, ENSRNOG00000042229: 63%
Entrez Gene ID: 170575
Uniprot ID: Q8WWP7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SILGQRRFFSRLGATSVTRACTTGSRRWDKCHVEVVDTPDIFSSQVSKTDPGCEERGHCYLL
• Gene Sequence: SILGQRRFFSRLGATSVTRACTTGSRRWDKCHVEVVDTPDIFSSQVSKTDPGCEERGHCYLL
• Gene ID - Mouse: ENSMUSG00000090019
• Gene ID - Rat: ENSRNOG00000042229
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.