Anti GIGYF2 pAb (ATL-HPA050899)

Atlas Antibodies

SKU: ATL-HPA050899-25

• 

Protein Description: GRB10 interacting GYF protein 2
Gene Name: GIGYF2
Alternative Gene Name: GYF2, KIAA0642, PARK11, PERQ2, PERQ3, TNRC15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048000: 95%, ENSRNOG00000023577: 95%
Entrez Gene ID: 26058
Uniprot ID: Q6Y7W6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QQYAQVLAQQQKAALSSQQQQQLALLLQQFQTLKMRISDQNIIPSVTRSVSVPDTGSIWELQPTASQPTVWEGGSVWDLPL
• Gene Sequence: QQYAQVLAQQQKAALSSQQQQQLALLLQQFQTLKMRISDQNIIPSVTRSVSVPDTGSIWELQPTASQPTVWEGGSVWDLPL
• Gene ID - Mouse: ENSMUSG00000048000
• Gene ID - Rat: ENSRNOG00000023577
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.