Anti GID8 pAb (ATL-HPA055047)

Atlas Antibodies

SKU: ATL-HPA055047-25

• 

Protein Description: GID complex subunit 8
Gene Name: GID8
Alternative Gene Name: bA305P22.1, C20orf11, FLJ20602, TWA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027573: 99%, ENSRNOG00000010180: 99%
Entrez Gene ID: 54994
Uniprot ID: Q9NWU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FDSPEESPFGDLLHTMQRQKVWSEVNQAVLDYENRESTPKLAKLLKLLLWAQNELDQKKVKYPKMTDLSKGVIE
• Gene Sequence: FDSPEESPFGDLLHTMQRQKVWSEVNQAVLDYENRESTPKLAKLLKLLLWAQNELDQKKVKYPKMTDLSKGVIE
• Gene ID - Mouse: ENSMUSG00000027573
• Gene ID - Rat: ENSRNOG00000010180
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.