Protein Description: golgi-associated, gamma adaptin ear containing, ARF binding protein 2
Gene Name: GGA2
Alternative Gene Name: KIAA1080, VEAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030872: 73%, ENSRNOG00000053118: 75%
Entrez Gene ID: 23062
Uniprot ID: Q9UJY4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GGA2
Alternative Gene Name: KIAA1080, VEAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030872: 73%, ENSRNOG00000053118: 75%
Entrez Gene ID: 23062
Uniprot ID: Q9UJY4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NCCEEKRNPSSSTLPGGGVQNPSADRNLLDLLSPQPAPCPLNYVSQKSVPKEVPPGTKSSPGWSWEAGPLAPSPSSQNTP |
| Documents & Links for Anti GGA2 pAb (ATL-HPA063634) | |
| Datasheet | Anti GGA2 pAb (ATL-HPA063634) Datasheet (External Link) |
| Vendor Page | Anti GGA2 pAb (ATL-HPA063634) at Atlas |
| Documents & Links for Anti GGA2 pAb (ATL-HPA063634) | |
| Datasheet | Anti GGA2 pAb (ATL-HPA063634) Datasheet (External Link) |
| Vendor Page | Anti GGA2 pAb (ATL-HPA063634) |