Protein Description: glial fibrillary acidic protein
Gene Name: GFAP
Alternative Gene Name: FLJ45472
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020932: 98%, ENSRNOG00000002919: 100%
Entrez Gene ID: 2670
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GFAP
Alternative Gene Name: FLJ45472
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020932: 98%, ENSRNOG00000002919: 100%
Entrez Gene ID: 2670
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human, Mouse |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKESKQEHKD |
Documents & Links for Anti GFAP pAb (ATL-HPA056030 w/enhanced validation) | |
Datasheet | Anti GFAP pAb (ATL-HPA056030 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GFAP pAb (ATL-HPA056030 w/enhanced validation) at Atlas |
Documents & Links for Anti GFAP pAb (ATL-HPA056030 w/enhanced validation) | |
Datasheet | Anti GFAP pAb (ATL-HPA056030 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GFAP pAb (ATL-HPA056030 w/enhanced validation) |
Citations for Anti GFAP pAb (ATL-HPA056030 w/enhanced validation) – 21 Found |
Yang, Bao; Yang, Chenlong; Fang, Jingyi; Yang, Jun; Xu, Yulun. Clinicoradiological characteristics, management and prognosis of primary myeloid sarcoma of the central nervous system: A report of four cases. Oncology Letters. 2017;14(3):3825-3831. PubMed |
Wu, Xian-Ping; She, Rui-Xuan; Yang, Yan-Ping; Xing, Zu-Min; Chen, Han-Wen; Zhang, Yi-Wen. MicroRNA-365 alleviates morphine analgesic tolerance via the inactivation of the ERK/CREB signaling pathway by negatively targeting β-arrestin2. Journal Of Biomedical Science. 2018;25(1):10. PubMed |
Yu, Xiaowen; Wang, Xiaoqing; Zeng, Shuxiong; Tuo, Xiping. Protective effects of primary neural stem cell treatment in ischemic stroke models. Experimental And Therapeutic Medicine. 2018;16(3):2219-2228. PubMed |
Bedri, Sahl Khalid; Nilsson, Ola B; Fink, Katharina; Månberg, Anna; Hamsten, Carl; Ayoglu, Burcu; Manouchehrinia, Ali; Nilsson, Peter; Olsson, Tomas; Hillert, Jan; Grönlund, Hans; Glaser, Anna. Plasma protein profiling reveals candidate biomarkers for multiple sclerosis treatment. Plos One. 14(5):e0217208. PubMed |
Sun, Zhixiong; Xu, Xiguang; He, Jianlin; Murray, Alexander; Sun, Ming-An; Wei, Xiaoran; Wang, Xia; McCoig, Emmarose; Xie, Evan; Jiang, Xi; Li, Liwu; Zhu, Jinsong; Chen, Jianjun; Morozov, Alexei; Pickrell, Alicia M; Theus, Michelle H; Xie, Hehuang. EGR1 recruits TET1 to shape the brain methylome during development and upon neuronal activity. Nature Communications. 2019;10(1):3892. PubMed |
Banerjee, Subhashis; Ghoshal, Sarbani; Girardet, Clemence; DeMars, Kelly M; Yang, Changjun; Niehoff, Michael L; Nguyen, Andrew D; Jayanth, Prerana; Hoelscher, Brittany A; Xu, Fenglian; Banks, William A; Hansen, Kim M; Zhang, Jinsong; Candelario-Jalil, Eduardo; Farr, Susan A; Butler, Andrew A. Adropin correlates with aging-related neuropathology in humans and improves cognitive function in aging mice. Npj Aging And Mechanisms Of Disease. 2021;7(1):23. PubMed |
Ben Khedher, Mohamed Raâfet; Haddad, Mohamed; Laurin, Danielle; Ramassamy, Charles. Effect of APOE ε4 allele on levels of apolipoproteins E, J, and D, and redox signature in circulating extracellular vesicles from cognitively impaired with no dementia participants converted to Alzheimer's disease. Alzheimer's & Dementia (Amsterdam, Netherlands). 13(1):e12231. PubMed |
Qu, Chang; Li, Qiao-Ping; Su, Zi-Ren; Ip, Siu-Po; Yuan, Qiu-Ju; Xie, You-Liang; Xu, Qing-Qing; Yang, Wen; Huang, Yan-Feng; Xian, Yan-Fang; Lin, Zhi-Xiu. Nano-Honokiol ameliorates the cognitive deficits in TgCRND8 mice of Alzheimer's disease via inhibiting neuropathology and modulating gut microbiota. Journal Of Advanced Research. 2022;35( 35024199):231-243. PubMed |
Zummo, Francesca; Esposito, Pietro; Hou, Huilei; Wetzl, Cecilia; Rius, Gemma; Tkatchenko, Raphaela; Guimera, Anton; Godignon, Philippe; Prato, Maurizio; Prats-Alfonso, Elisabet; Criado, Alejandro; Scaini, Denis. Bidirectional Modulation of Neuronal Cells Electrical and Mechanical Properties Through Pristine and Functionalized Graphene Substrates. Frontiers In Neuroscience. 15( 35087375):811348. PubMed |
Privat-Maldonado, Angela; Verloy, Ruben; Cardenas Delahoz, Edgar; Lin, Abraham; Vanlanduit, Steve; Smits, Evelien; Bogaerts, Annemie. Cold Atmospheric Plasma Does Not Affect Stellate Cells Phenotype in Pancreatic Cancer Tissue in Ovo. International Journal Of Molecular Sciences. 2022;23(4) PubMed |
Anstötz, Max; Maccaferri, Gianmaria. A Toolbox of Criteria for Distinguishing Cajal-Retzius Cells from Other Neuronal Types in the Postnatal Mouse Hippocampus. Eneuro. 2020;7(1) PubMed |
Gao, Mei-Ling; Lei, Xin-Lan; Han, Fang; He, Kai-Wen; Jin, Si-Qian; Zhang, You-You; Jin, Zi-Bing. Patient-Specific Retinal Organoids Recapitulate Disease Features of Late-Onset Retinitis Pigmentosa. Frontiers In Cell And Developmental Biology. 8( 32211407):128. PubMed |
Yang, Wen; Liu, Yue; Xu, Qing-Qing; Xian, Yan-Fang; Lin, Zhi-Xiu. Sulforaphene Ameliorates Neuroinflammation and Hyperphosphorylated Tau Protein via Regulating the PI3K/Akt/GSK-3β Pathway in Experimental Models of Alzheimer's Disease. Oxidative Medicine And Cellular Longevity. 2020( 32963694):4754195. PubMed |
Prpar Mihevc, Sonja; Zakošek Pipan, Maja; Štrbenc, Malan; Rogelj, Boris; Majdič, Gregor. Nitrosative Stress in the Frontal Cortex From Dogs With Canine Cognitive Dysfunction. Frontiers In Veterinary Science. 7( 33330694):573155. PubMed |
Seguella, Luisa; Pesce, Mirella; Capuano, Riccardo; Casano, Fabrizio; Pesce, Marcella; Corpetti, Chiara; Vincenzi, Martina; Maftei, Daniela; Lattanzi, Roberta; Del Re, Alessandro; Sarnelli, Giovanni; Gulbransen, Brian D; Esposito, Giuseppe. High-fat diet impairs duodenal barrier function and elicits glia-dependent changes along the gut-brain axis that are required for anxiogenic and depressive-like behaviors. Journal Of Neuroinflammation. 2021;18(1):115. PubMed |
Jing, Yingli; Bai, Fan; Wang, Limiao; Yang, Degang; Yan, Yitong; Wang, Qiuying; Zhu, Yanbing; Yu, Yan; Chen, Zhiguo. Fecal Microbiota Transplantation Exerts Neuroprotective Effects in a Mouse Spinal Cord Injury Model by Modulating the Microenvironment at the Lesion Site. Microbiology Spectrum. 2022;10(3):e0017722. PubMed |
Zou, Liang; Tian, Huihui; Guan, Shouliang; Ding, Jianfei; Gao, Lei; Wang, Jinfen; Fang, Ying. Self-assembled multifunctional neural probes for precise integration of optogenetics and electrophysiology. Nature Communications. 2021;12(1):5871. PubMed |
Takahashi, Tohru M; Hirano, Arisa; Kanda, Takeshi; Saito, Viviane M; Ashitomi, Hiroto; Tanaka, Kazumasa Z; Yokoshiki, Yasufumi; Masuda, Kosaku; Yanagisawa, Masashi; Vogt, Kaspar E; Tokuda, Takashi; Sakurai, Takeshi. Optogenetic induction of hibernation-like state with modified human Opsin4 in mice. Cell Reports Methods. 2022;2(11):100336. PubMed |
Zou, Liang; Wang, Jinfen; Fang, Ying; Tian, Huihui. PEG-mediated transduction of rAAV as a platform for spatially confined and efficient gene delivery. Biomaterials Research. 2022;26(1):69. PubMed |
Provenzano, Francesca; Nyberg, Sophie; Giunti, Debora; Torazza, Carola; Parodi, Benedetta; Bonifacino, Tiziana; Usai, Cesare; Kerlero de Rosbo, Nicole; Milanese, Marco; Uccelli, Antonio; Shaw, Pamela J; Ferraiuolo, Laura; Bonanno, Giambattista. Micro-RNAs Shuttled by Extracellular Vesicles Secreted from Mesenchymal Stem Cells Dampen Astrocyte Pathological Activation and Support Neuroprotection in In-Vitro Models of ALS. Cells. 2022;11(23) PubMed |
Xu, Qing-Qing; Su, Zi-Ren; Yang, Wen; Zhong, Mei; Xian, Yan-Fang; Lin, Zhi-Xiu. Patchouli alcohol attenuates the cognitive deficits in a transgenic mouse model of Alzheimer's disease via modulating neuropathology and gut microbiota through suppressing C/EBPβ/AEP pathway. Journal Of Neuroinflammation. 2023;20(1):19. PubMed |