Protein Description: glycerophosphodiester phosphodiesterase 1
Gene Name: GDE1
Alternative Gene Name: MIR16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033917: 86%, ENSRNOG00000050445: 88%
Entrez Gene ID: 51573
Uniprot ID: Q9NZC3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GDE1
Alternative Gene Name: MIR16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033917: 86%, ENSRNOG00000050445: 88%
Entrez Gene ID: 51573
Uniprot ID: Q9NZC3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | AKNGATGVELDIEFTSDGIPVLMHDNTVDRTTDGTGRLCDLTFEQIRKLNPAANHRLRNDFPDEKIPTLREAVAECLNHNLTIFFDVKGHAHKATEALKKMYMEFPQL |
Documents & Links for Anti GDE1 pAb (ATL-HPA074747) | |
Datasheet | Anti GDE1 pAb (ATL-HPA074747) Datasheet (External Link) |
Vendor Page | Anti GDE1 pAb (ATL-HPA074747) at Atlas |
Documents & Links for Anti GDE1 pAb (ATL-HPA074747) | |
Datasheet | Anti GDE1 pAb (ATL-HPA074747) Datasheet (External Link) |
Vendor Page | Anti GDE1 pAb (ATL-HPA074747) |