Anti GDAP2 pAb (ATL-HPA046185 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA046185-25

• 
• 
• 

Protein Description: ganglioside induced differentiation associated protein 2
Gene Name: GDAP2
Alternative Gene Name: dJ776P7.1, FLJ20142, MACROD3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027865: 88%, ENSRNOG00000019754: 92%
Entrez Gene ID: 54834
Uniprot ID: Q9NXN4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LNSSDTTAEIFQEDTVRSPFLYNKDVNGKVVLWKGDVALLNCTAIVNTSNESLTDKNPVSESIFMLAGPDLKEDLQKLKGCRTGEAKL
• Gene Sequence: LNSSDTTAEIFQEDTVRSPFLYNKDVNGKVVLWKGDVALLNCTAIVNTSNESLTDKNPVSESIFMLAGPDLKEDLQKLKGCRTGEAKL
• Gene ID - Mouse: ENSMUSG00000027865
• Gene ID - Rat: ENSRNOG00000019754
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.