Anti GDAP1L1 pAb (ATL-HPA063265)

Atlas Antibodies

SKU: ATL-HPA063265-25

• 

Protein Description: ganglioside induced differentiation associated protein 1-like 1
Gene Name: GDAP1L1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017943: 97%, ENSRNOG00000008790: 97%
Entrez Gene ID: 78997
Uniprot ID: Q96MZ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FMRLNLGEEVPVIIHRDNIISDYDQIIDYVERTFTGEHVVALMPEVGSLQHARVLQYREL
• Gene Sequence: FMRLNLGEEVPVIIHRDNIISDYDQIIDYVERTFTGEHVVALMPEVGSLQHARVLQYREL
• Gene ID - Mouse: ENSMUSG00000017943
• Gene ID - Rat: ENSRNOG00000008790
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.