Protein Description: ganglioside induced differentiation associated protein 1-like 1
Gene Name: GDAP1L1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017943: 97%, ENSRNOG00000008790: 97%
Entrez Gene ID: 78997
Uniprot ID: Q96MZ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GDAP1L1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017943: 97%, ENSRNOG00000008790: 97%
Entrez Gene ID: 78997
Uniprot ID: Q96MZ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | FMRLNLGEEVPVIIHRDNIISDYDQIIDYVERTFTGEHVVALMPEVGSLQHARVLQYREL |
| Documents & Links for Anti GDAP1L1 pAb (ATL-HPA063265) | |
| Datasheet | Anti GDAP1L1 pAb (ATL-HPA063265) Datasheet (External Link) |
| Vendor Page | Anti GDAP1L1 pAb (ATL-HPA063265) at Atlas |
| Documents & Links for Anti GDAP1L1 pAb (ATL-HPA063265) | |
| Datasheet | Anti GDAP1L1 pAb (ATL-HPA063265) Datasheet (External Link) |
| Vendor Page | Anti GDAP1L1 pAb (ATL-HPA063265) |