Anti GDAP1L1 pAb (ATL-HPA063265)
Atlas Antibodies
- SKU:
- ATL-HPA063265-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GDAP1L1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017943: 97%, ENSRNOG00000008790: 97%
Entrez Gene ID: 78997
Uniprot ID: Q96MZ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FMRLNLGEEVPVIIHRDNIISDYDQIIDYVERTFTGEHVVALMPEVGSLQHARVLQYREL |
Gene Sequence | FMRLNLGEEVPVIIHRDNIISDYDQIIDYVERTFTGEHVVALMPEVGSLQHARVLQYREL |
Gene ID - Mouse | ENSMUSG00000017943 |
Gene ID - Rat | ENSRNOG00000008790 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GDAP1L1 pAb (ATL-HPA063265) | |
Datasheet | Anti GDAP1L1 pAb (ATL-HPA063265) Datasheet (External Link) |
Vendor Page | Anti GDAP1L1 pAb (ATL-HPA063265) at Atlas Antibodies |
Documents & Links for Anti GDAP1L1 pAb (ATL-HPA063265) | |
Datasheet | Anti GDAP1L1 pAb (ATL-HPA063265) Datasheet (External Link) |
Vendor Page | Anti GDAP1L1 pAb (ATL-HPA063265) |