Anti GCNT7 pAb (ATL-HPA052617)

Atlas Antibodies

SKU: ATL-HPA052617-25

• 
• 

Protein Description: glucosaminyl (N-acetyl) transferase family member 7
Gene Name: GCNT7
Alternative Gene Name: C20orf105, dJ1153D9.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074569: 48%, ENSRNOG00000021551: 55%
Entrez Gene ID: 140687
Uniprot ID: Q6ZNI0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TNREIIHYIRSKWSDKNITPGVIQPLHIKSKTSQSHLEFVPKGSIYAPPNNRFKDKPP
• Gene Sequence: TNREIIHYIRSKWSDKNITPGVIQPLHIKSKTSQSHLEFVPKGSIYAPPNNRFKDKPP
• Gene ID - Mouse: ENSMUSG00000074569
• Gene ID - Rat: ENSRNOG00000021551
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.