Anti GCN1 pAb (ATL-HPA024367 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA024367-25
- Shipping:
- Calculated at Checkout
$447.00
Product Description
Protein Description: GCN1 eIF2 alpha kinase activator homolog
Gene Name: GCN1
Alternative Gene Name: GCN1L, GCN1L1, KIAA0219
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041638: 87%, ENSRNOG00000021871: 87%
Entrez Gene ID: 10985
Uniprot ID: Q92616
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GCN1
Alternative Gene Name: GCN1L, GCN1L1, KIAA0219
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041638: 87%, ENSRNOG00000021871: 87%
Entrez Gene ID: 10985
Uniprot ID: Q92616
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LLPLLIQTVEKAASQSTQVPTITEGVAAALLLLKLSVADSQAEAKLSSFWQLIVDEKKQVFTSEKFLVMASEDALCTVLHLTERLFLDHPHRLTGNKVQQYHRALVAVLLSRTWHVRRQAQQTVRKLLSSL |
Gene Sequence | LLPLLIQTVEKAASQSTQVPTITEGVAAALLLLKLSVADSQAEAKLSSFWQLIVDEKKQVFTSEKFLVMASEDALCTVLHLTERLFLDHPHRLTGNKVQQYHRALVAVLLSRTWHVRRQAQQTVRKLLSSL |
Gene ID - Mouse | ENSMUSG00000041638 |
Gene ID - Rat | ENSRNOG00000021871 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti GCN1 pAb (ATL-HPA024367 w/enhanced validation) | |
Datasheet | Anti GCN1 pAb (ATL-HPA024367 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GCN1 pAb (ATL-HPA024367 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti GCN1 pAb (ATL-HPA024367 w/enhanced validation) | |
Datasheet | Anti GCN1 pAb (ATL-HPA024367 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GCN1 pAb (ATL-HPA024367 w/enhanced validation) |