Anti GCN1 pAb (ATL-HPA024367 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA024367-25
  • Immunohistochemical staining of human skeletal muscle, skin, stomach and testis using Anti-GCN1 antibody HPA024367 (A) shows similar protein distribution across tissues to independent antibody HPA018799 (B).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: GCN1 eIF2 alpha kinase activator homolog
Gene Name: GCN1
Alternative Gene Name: GCN1L, GCN1L1, KIAA0219
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041638: 87%, ENSRNOG00000021871: 87%
Entrez Gene ID: 10985
Uniprot ID: Q92616
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLPLLIQTVEKAASQSTQVPTITEGVAAALLLLKLSVADSQAEAKLSSFWQLIVDEKKQVFTSEKFLVMASEDALCTVLHLTERLFLDHPHRLTGNKVQQYHRALVAVLLSRTWHVRRQAQQTVRKLLSSL
Gene Sequence LLPLLIQTVEKAASQSTQVPTITEGVAAALLLLKLSVADSQAEAKLSSFWQLIVDEKKQVFTSEKFLVMASEDALCTVLHLTERLFLDHPHRLTGNKVQQYHRALVAVLLSRTWHVRRQAQQTVRKLLSSL
Gene ID - Mouse ENSMUSG00000041638
Gene ID - Rat ENSRNOG00000021871
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GCN1 pAb (ATL-HPA024367 w/enhanced validation)
Datasheet Anti GCN1 pAb (ATL-HPA024367 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GCN1 pAb (ATL-HPA024367 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GCN1 pAb (ATL-HPA024367 w/enhanced validation)
Datasheet Anti GCN1 pAb (ATL-HPA024367 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GCN1 pAb (ATL-HPA024367 w/enhanced validation)