Anti GCHFR pAb (ATL-HPA046258)
Atlas Antibodies
- SKU:
- ATL-HPA046258-100
![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/93550/170306/atl-hpa046258_anti-gchfr-pab-atl-hpa046258_51958__73790.1681123962.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue")
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: GCHFR
Alternative Gene Name: GFRP, HsT16933
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046814: 93%, ENSRNOG00000012290: 94%
Entrez Gene ID: 2644
Uniprot ID: P30047
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTLVWCLHKE |
| Gene Sequence | MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTLVWCLHKE |
| Gene ID - Mouse | ENSMUSG00000046814 |
| Gene ID - Rat | ENSRNOG00000012290 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GCHFR pAb (ATL-HPA046258) | |
| Datasheet | Anti GCHFR pAb (ATL-HPA046258) Datasheet (External Link) |
| Vendor Page | Anti GCHFR pAb (ATL-HPA046258) at Atlas Antibodies |
| Documents & Links for Anti GCHFR pAb (ATL-HPA046258) | |
| Datasheet | Anti GCHFR pAb (ATL-HPA046258) Datasheet (External Link) |
| Vendor Page | Anti GCHFR pAb (ATL-HPA046258) |
| Citations for Anti GCHFR pAb (ATL-HPA046258) – 1 Found |
| Shioda, Norifumi; Imai, Yoshiki; Yabuki, Yasushi; Sugimoto, Wataru; Yamaguchi, Kouya; Wang, Yanyan; Hikida, Takatoshi; Sasaoka, Toshikuni; Mieda, Michihiro; Fukunaga, Kohji. Dopamine D(2L) Receptor Deficiency Causes Stress Vulnerability through 5-HT(1A) Receptor Dysfunction in Serotonergic Neurons. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2019;39(38):7551-7563. PubMed |