Anti GCAT pAb (ATL-HPA063924)
Atlas Antibodies
- SKU:
- ATL-HPA063924-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GCAT
Alternative Gene Name: KBL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006378: 93%, ENSRNOG00000055408: 94%
Entrez Gene ID: 23464
Uniprot ID: O75600
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RGAGTWKSERVITSRQGPHIRVDGVSGGILNFCANNYLGLSSHPEVIQAGLQALEEFGAGLSSVRFICGTQ |
Gene Sequence | RGAGTWKSERVITSRQGPHIRVDGVSGGILNFCANNYLGLSSHPEVIQAGLQALEEFGAGLSSVRFICGTQ |
Gene ID - Mouse | ENSMUSG00000006378 |
Gene ID - Rat | ENSRNOG00000055408 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GCAT pAb (ATL-HPA063924) | |
Datasheet | Anti GCAT pAb (ATL-HPA063924) Datasheet (External Link) |
Vendor Page | Anti GCAT pAb (ATL-HPA063924) at Atlas Antibodies |
Documents & Links for Anti GCAT pAb (ATL-HPA063924) | |
Datasheet | Anti GCAT pAb (ATL-HPA063924) Datasheet (External Link) |
Vendor Page | Anti GCAT pAb (ATL-HPA063924) |