Protein Description: glycine C-acetyltransferase
Gene Name: GCAT
Alternative Gene Name: KBL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006378: 93%, ENSRNOG00000055408: 94%
Entrez Gene ID: 23464
Uniprot ID: O75600
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GCAT
Alternative Gene Name: KBL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006378: 93%, ENSRNOG00000055408: 94%
Entrez Gene ID: 23464
Uniprot ID: O75600
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RGAGTWKSERVITSRQGPHIRVDGVSGGILNFCANNYLGLSSHPEVIQAGLQALEEFGAGLSSVRFICGTQ |
| Documents & Links for Anti GCAT pAb (ATL-HPA063924) | |
| Datasheet | Anti GCAT pAb (ATL-HPA063924) Datasheet (External Link) |
| Vendor Page | Anti GCAT pAb (ATL-HPA063924) at Atlas |
| Documents & Links for Anti GCAT pAb (ATL-HPA063924) | |
| Datasheet | Anti GCAT pAb (ATL-HPA063924) Datasheet (External Link) |
| Vendor Page | Anti GCAT pAb (ATL-HPA063924) |