Anti GBP3 pAb (ATL-HPA045657)
Atlas Antibodies
- SKU:
- ATL-HPA045657-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GBP3
Alternative Gene Name: FLJ10961
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022565: 39%, ENSRNOG00000053428: 43%
Entrez Gene ID: 2635
Uniprot ID: Q9H0R5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LLEEQEKTLTSKLQEQARVLKERCQGESTQLQNEIQKLQKTLKKKTKRYMSHK |
Gene Sequence | LLEEQEKTLTSKLQEQARVLKERCQGESTQLQNEIQKLQKTLKKKTKRYMSHK |
Gene ID - Mouse | ENSMUSG00000022565 |
Gene ID - Rat | ENSRNOG00000053428 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GBP3 pAb (ATL-HPA045657) | |
Datasheet | Anti GBP3 pAb (ATL-HPA045657) Datasheet (External Link) |
Vendor Page | Anti GBP3 pAb (ATL-HPA045657) at Atlas Antibodies |
Documents & Links for Anti GBP3 pAb (ATL-HPA045657) | |
Datasheet | Anti GBP3 pAb (ATL-HPA045657) Datasheet (External Link) |
Vendor Page | Anti GBP3 pAb (ATL-HPA045657) |