Anti GAN pAb (ATL-HPA049473)

Atlas Antibodies

SKU:
ATL-HPA049473-25
  • Immunohistochemical staining of human skin shows weak cytoplasmic positivity in squamous epithelial cells.
  • Immunofluorescent staining of human cell line RT4 shows localization to microtubules.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: gigaxonin
Gene Name: GAN
Alternative Gene Name: GAN1, KLHL16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052557: 99%, ENSRNOG00000012671: 99%
Entrez Gene ID: 8139
Uniprot ID: Q9H2C0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ACGVAMELYVFGGVRSREDAQGSEMVTCKSEFYHDEFKRWIYLNDQNLCIPASSSFVYGAVPIGASIYVIGDLDTGTNYDYVREFKRSTG
Gene Sequence ACGVAMELYVFGGVRSREDAQGSEMVTCKSEFYHDEFKRWIYLNDQNLCIPASSSFVYGAVPIGASIYVIGDLDTGTNYDYVREFKRSTG
Gene ID - Mouse ENSMUSG00000052557
Gene ID - Rat ENSRNOG00000012671
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GAN pAb (ATL-HPA049473)
Datasheet Anti GAN pAb (ATL-HPA049473) Datasheet (External Link)
Vendor Page Anti GAN pAb (ATL-HPA049473) at Atlas Antibodies

Documents & Links for Anti GAN pAb (ATL-HPA049473)
Datasheet Anti GAN pAb (ATL-HPA049473) Datasheet (External Link)
Vendor Page Anti GAN pAb (ATL-HPA049473)