Anti GALNT8 pAb (ATL-HPA073461)

Atlas Antibodies

SKU: ATL-HPA073461-25

• 

Product Description

Protein Description: polypeptide N-acetylgalactosaminyltransferase 8
Gene Name: GALNT8
Alternative Gene Name: GALNAC-T8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038296: 40%, ENSRNOG00000017021: 40%
Entrez Gene ID: 26290
Uniprot ID: Q9NY28
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QMKLFPHSQLFRQWGEDLSEAQQKAAQDLFRKFGYNAYLSNQLPLNRTIPDTRDYRCLRKTYPSQLPSLSVI
• Gene Sequence: QMKLFPHSQLFRQWGEDLSEAQQKAAQDLFRKFGYNAYLSNQLPLNRTIPDTRDYRCLRKTYPSQLPSLSVI
• Gene ID - Mouse: ENSMUSG00000038296
• Gene ID - Rat: ENSRNOG00000017021
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links