Protein Description: polypeptide N-acetylgalactosaminyltransferase 8
Gene Name: GALNT8
Alternative Gene Name: GALNAC-T8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038296: 40%, ENSRNOG00000017021: 40%
Entrez Gene ID: 26290
Uniprot ID: Q9NY28
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GALNT8
Alternative Gene Name: GALNAC-T8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038296: 40%, ENSRNOG00000017021: 40%
Entrez Gene ID: 26290
Uniprot ID: Q9NY28
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QMKLFPHSQLFRQWGEDLSEAQQKAAQDLFRKFGYNAYLSNQLPLNRTIPDTRDYRCLRKTYPSQLPSLSVI |
| Documents & Links for Anti GALNT8 pAb (ATL-HPA073461) | |
| Datasheet | Anti GALNT8 pAb (ATL-HPA073461) Datasheet (External Link) |
| Vendor Page | Anti GALNT8 pAb (ATL-HPA073461) at Atlas |
| Documents & Links for Anti GALNT8 pAb (ATL-HPA073461) | |
| Datasheet | Anti GALNT8 pAb (ATL-HPA073461) Datasheet (External Link) |
| Vendor Page | Anti GALNT8 pAb (ATL-HPA073461) |