Anti GADD45A pAb (ATL-HPA053420)

Atlas Antibodies

SKU: ATL-HPA053420-25

• 

Protein Description: growth arrest and DNA-damage-inducible, alpha
Gene Name: GADD45A
Alternative Gene Name: DDIT1, GADD45
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036390: 91%, ENSRNOG00000005615: 88%
Entrez Gene ID: 1647
Uniprot ID: P24522
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQ
• Gene Sequence: MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQ
• Gene ID - Mouse: ENSMUSG00000036390
• Gene ID - Rat: ENSRNOG00000005615
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GADD45A pAb (ATL-HPA053420) – 1 Found

Zhao, Liang; Cheng, Zhe; Lu, Zhiyue; Jin, Jianqiu. NAD-dependent methylenetetrahydrofolate dehydrogenase inhibits oral squamous cell carcinoma cell proliferation and promotes apoptosis. Translational Cancer Research. 2021;10(3):1457-1469.